DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and AT3G01085

DIOPT Version :10

Sequence 1:NP_477163.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001325617.1 Gene:AT3G01085 / 821283 AraportID:AT3G01085 Length:631 Species:Arabidopsis thaliana


Alignment Length:99 Identity:21/99 - (21%)
Similarity:42/99 - (42%) Gaps:32/99 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 LSIICGVIPLV---FGAI----FFFMPESPYYFVEKGRYSEAASSLKWLRGAQYDENAE---IED 231
            |.||...:.|:   ||::    ..|..|..|:.::           ::|.|.:..|.::   ::.
plant    80 LEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILD-----------EFLLGGEVQETSKKNVLKA 133

  Fly   232 LKQADEKVKAEAIPMLVAFRQKATVRALAISLGL 265
            ::||| .::.||          .|.|::...:||
plant   134 IEQAD-LLQEEA----------ETPRSVLEEIGL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_477163.1 STKc_p38 9..354 CDD:143356 21/99 (21%)
AT3G01085NP_001325617.1 STKc_CDK9_like 115..400 CDD:270832 12/53 (23%)

Return to query results.
Submit another query.