DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and MPK20

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_565989.1 Gene:MPK20 / 818888 AraportID:AT2G42880 Length:606 Species:Arabidopsis thaliana


Alignment Length:370 Identity:146/370 - (39%)
Similarity:216/370 - (58%) Gaps:32/370 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NRTEWEIPDIYQDL------QPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYREL 73
            |..|.|....|.|.      :.:|.|:||.|..|:...|...|||||:...|:....|.|..||:
plant     9 NNLEMEFFSDYGDANRFKVQEVIGKGSYGVVCSAIDTLTGEKVAIKKIHDIFEHISDAARILREI 73

  Fly    74 RLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRM-QHLSDDHVQFLVYQ 137
            :||:.:.|.:::.:..|..|    .|...|:.:|:|..||::||:.:|:. ..|:.:|.||.:||
plant    74 KLLRLLRHPDIVEIKHIMLP----PSRREFKDIYVVFELMESDLHQVIKANDDLTREHYQFFLYQ 134

  Fly   138 ILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLAR------PTENEMTGYVATRWYRAPE 196
            :||.|||||:|.|.||||||.||..|.:|:|:|.||||||      ||....|.|||||||||||
plant   135 LLRALKYIHTANVYHRDLKPKNILANANCKLKICDFGLARVAFNDTPTTIFWTDYVATRWYRAPE 199

  Fly   197 IMLN-WMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESAR 260
            :..: :..|...:||||:|||.||::..:.||||.:.:|||:|:.::||||..:.:.::.:|.||
plant   200 LCGSFYSKYTPAIDIWSIGCIFAEVLMGKPLFPGKNVVHQLDLMTDLLGTPSLDTISRVRNEKAR 264

  Fly   261 SYIQSL---PPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQ 322
            .|:.|:   ||:   .|...|.||:||::.|||::|..|.:.|.||||||:.||.:..|:...|.
plant   265 RYLTSMRKKPPI---PFAQKFPNADPLSLKLLERLLAFDPKDRPTAEEALADPYFKGLAKVEREP 326

  Fly   323 TSPP---YDHSFEDMDLPVDKWKELIYKEVTNFKPPPSYAQVLKD 364
            :..|   .:..||...:..:..:|||.:|:..:.|     |:|||
plant   327 SCQPITKMEFEFERRKVTKEDIRELISREILEYHP-----QLLKD 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 141/358 (39%)
S_TKc 25..312 CDD:214567 128/303 (42%)
MPK20NP_565989.1 STKc_TDY_MAPK 24..361 CDD:143364 136/343 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.