DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and MPK17

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001030939.1 Gene:MPK17 / 814673 AraportID:AT2G01450 Length:486 Species:Arabidopsis thaliana


Alignment Length:371 Identity:141/371 - (38%)
Similarity:220/371 - (59%) Gaps:26/371 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRT 69
            :.|:|:      ||:.....||..:.||.|:||.|:.|....|...|||||:...|:....|.|.
plant     2 LEKEFF------TEYGEASQYQIQEVVGKGSYGVVASAECPHTGGKVAIKKMTNVFEHVSDAIRI 60

  Fly    70 YRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRM-QHLSDDHVQF 133
            .||::||:.:.|.:::.:..|..| |..   :.|:.:|:|..||::||:::::: ..|:..|.||
plant    61 LREIKLLRLLRHPDIVEIKHIMLP-PCR---KEFKDIYVVFELMESDLHHVLKVNDDLTPQHHQF 121

  Fly   134 LVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLAR------PTENEMTGYVATRWY 192
            .:||:|||||::|||.|.||||||.||..|.||:::|.|.||||      |:....|.|||||||
plant   122 FLYQLLRGLKFMHSAHVFHRDLKPKNILANADCKIKICDLGLARVSFTDSPSAVFWTDYVATRWY 186

  Fly   193 RAPEIMLN-WMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISS 256
            ||||:..: :.:|...:|:||||||.||::|.:.||||.:.:|||.|:.::||||....|.:|.:
plant   187 RAPELCGSFYSNYTPAIDMWSVGCIFAEMLTGKPLFPGKNVVHQLELVTDLLGTPSPITLSRIRN 251

  Fly   257 ESARSYIQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVE 321
            |.||.|:.::.......|.:.|.|.:|:|:.||::::..|.:.|.:|||||:.||.:..|....|
plant   252 EKARKYLGNMRRKDPVPFTHKFPNIDPVALKLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYE 316

  Fly   322 QTSPP---YDHSFEDMDLPVDKWKELIYKEVTNFKPPPSYAQVLKD 364
            .:..|   .:..||...|..|..:||:|:|:..:.|     |:|::
plant   317 PSRQPISKLEFEFERRKLTRDDVRELMYREILEYHP-----QMLQE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 137/355 (39%)
S_TKc 25..312 CDD:214567 122/294 (41%)
MPK17NP_001030939.1 STKc_TDY_MAPK 15..352 CDD:143364 134/340 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.