DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and MAPK12

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_002960.2 Gene:MAPK12 / 6300 HGNCID:6874 Length:367 Species:Homo sapiens


Alignment Length:357 Identity:208/357 - (58%)
Similarity:273/357 - (76%) Gaps:4/357 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYREL 73
            ||:.::.:|.||:..:|:|||||||||||.|..||...|...||||||.|||||.:.|||.||||
Human    11 FYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYREL 75

  Fly    74 RLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQI 138
            ||||||.|||||||||:|.|   :.:|::|...|||...|..||..:::.:.|.:|.:||||||:
Human    76 RLLKHMRHENVIGLLDVFTP---DETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQM 137

  Fly   139 LRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAPEIMLNWMH 203
            |:||:|||:||:|||||||.|:||||||||:||||||||..::||||||.||||||||::||||.
Human   138 LKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMR 202

  Fly   204 YDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPP 268
            |.||||||||||||||:||.:|||.|:||:.||..||::.|||||||::::.|:.|::|::.||.
Human   203 YTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPE 267

  Fly   269 MKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPPYDHSFED 333
            ::.:.|.::..||:|||::||||||.||||:|:||.|||:|||.|...:...|.....||.||:|
Human   268 LEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDD 332

  Fly   334 MDLPVDKWKELIYKEVTNFKPPPSY-AQVLKD 364
            :|..:|:||.:.||||.:||||... |:|.|:
Human   333 VDRTLDEWKRVTYKEVLSFKPPRQLGARVSKE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 202/344 (59%)
S_TKc 25..312 CDD:214567 180/286 (63%)
MAPK12NP_002960.2 STKc_p38gamma 11..353 CDD:143385 202/344 (59%)
TXY 183..185 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11342
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 1 1.000 - - FOG0000533
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X352
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.