DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and MAPK7

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_006721620.1 Gene:MAPK7 / 5598 HGNCID:6880 Length:822 Species:Homo sapiens


Alignment Length:349 Identity:163/349 - (46%)
Similarity:230/349 - (65%) Gaps:18/349 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHEN 83
            :::.|.|:.::.:|:||||.||.|..|.|...|||||:...|....:||||.|||::|||..|:|
Human    49 FDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDN 113

  Fly    84 VIGLLDIFHPHPANGSLENFQQV------YLVTHLMDADLNNIIR-MQHLSDDHVQFLVYQILRG 141
            :|.:.||..|....|   .|:.|      |:|..||::||:.||. .|.|:.:||::.:||:|||
Human   114 IIAIKDILRPTVPYG---EFKSVPYGVPGYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRG 175

  Fly   142 LKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLAR-----PTENE--MTGYVATRWYRAPEIML 199
            |||:|||.||||||||||:.|||:|||:|.|||:||     |.|::  ||.|||||||||||:||
Human   176 LKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELML 240

  Fly   200 NWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQ 264
            :...|.|.:|:||||||..|::.||.||||.:::|||.|||.:||||....::.:.:|..|:|||
Human   241 SLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQ 305

  Fly   265 SLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVE-QTSPPYD 328
            ||||.:...::.|:..|:..|:.||.:||..:...||:|..||.||:|.||.:|..| ..:||:|
Human   306 SLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPPFD 370

  Fly   329 HSFEDMDLPVDKWKELIYKEVTNF 352
            .:|:...|..::.||.|..|:.:|
Human   371 FAFDREALTRERIKEAIVAEIEDF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 163/349 (47%)
S_TKc 25..312 CDD:214567 147/300 (49%)
MAPK7XP_006721620.1 STKc_ERK5 49..390 CDD:270842 161/343 (47%)
S_TKc 55..353 CDD:214567 147/300 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.