DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and Mapk4

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_062192.1 Gene:Mapk4 / 54268 RGDID:3047 Length:583 Species:Rattus norvegicus


Alignment Length:327 Identity:116/327 - (35%)
Similarity:184/327 - (56%) Gaps:30/327 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLD 89
            :.|.||:|.|..|.|..|........||:||:.  ...|...|...||:::::.:||:|::.:.:
  Rat    20 FTDFQPLGFGVNGLVLSATDSRACRKVAVKKIV--LSDARSMKHALREIKIIRRLDHDNIVKVYE 82

  Fly    90 IFHPHPAN--GSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIH 152
            :..|..::  |.|..|...|:|...|:.||..::....|:::|.:..:||:||||||||||.|:|
  Rat    83 VLGPKGSDLQGELFKFSVAYIVQEYMETDLACLLEQGTLTEEHAKLFMYQLLRGLKYIHSANVLH 147

  Fly   153 RDLKPSNIAVN-EDCELRILDFGLARPTENEMT--GYVA----TRWYRAPEIMLNWMHYDQTVDI 210
            |||||:||.:: ||..|:|.||||||..:...:  ||::    |:|||:|.::|:..:|.:.:|:
  Rat   148 RDLKPANIFISTEDLVLKIGDFGLARIADQHYSHKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDM 212

  Fly   211 WSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPA-------EFLKKISSESARSYIQSLPP 268
            |:.|||:||::|.:.||.|...:.|:.||::   |.|.       |.|:.:.     |::.|...
  Rat   213 WAAGCILAEMLTGKMLFAGAHELEQMQLILD---TIPVVREEDKEELLRVMP-----SFVSSTWE 269

  Fly   269 MKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPPYDHSFED 333
            :| |..:.:..:.|..|||.|||:|..:...|:|||..|.|||:..|:.|..|.||   .|.|..
  Rat   270 VK-RPLRKLLPDVNREAIDFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTS---QHPFRI 330

  Fly   334 MD 335
            .|
  Rat   331 ED 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 116/327 (35%)
S_TKc 25..312 CDD:214567 107/302 (35%)
Mapk4NP_062192.1 STKc_MAPK4_6 14..351 CDD:143359 116/327 (35%)
Pkinase 20..312 CDD:278497 107/302 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.