DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and CDK12

DIOPT Version :10

Sequence 1:NP_477163.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_057591.2 Gene:CDK12 / 51755 HGNCID:24224 Length:1490 Species:Homo sapiens


Alignment Length:38 Identity:9/38 - (23%)
Similarity:13/38 - (34%) Gaps:13/38 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 LVTKVFTNLKDAMGEA-------------GVFWLFSGI 433
            |:..:..||.||...|             .:.|.||.:
Human   166 LIEVIHLNLDDAQAFADNPDIPKTLGVIYAISWFFSQV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_477163.1 STKc_p38 9..354 CDD:143356
CDK12NP_057591.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..703 9/38 (24%)
STKc_CDK12 719..1020 CDD:270847
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1047..1098
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1161..1189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1220..1348
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1441..1460
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1466..1490
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.