DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and mapk4

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_998638.1 Gene:mapk4 / 406782 ZFINID:ZDB-GENE-040426-2835 Length:674 Species:Danio rerio


Alignment Length:329 Identity:123/329 - (37%)
Similarity:191/329 - (58%) Gaps:32/329 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLD 89
            ||||:|:|:||.|.|..|:.|.:.:.||:|||.  .:.||..|...||:::.:.:.||||:.:.|
Zfish    19 YQDLRPLGTGASGLVLSALDRRSGLRVAVKKLV--MRDAVSVKHALREVKITRRLQHENVVRVYD 81

  Fly    90 IF----HPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGV 150
            :.    ||.|.:  |.:...:|:|...|:.||..::....|..:|...|.||:|||||:||||.|
Zfish    82 VLGSSGHPLPRD--LTHVAAIYIVQECMETDLARLLEQGPLPAEHATLLFYQLLRGLKFIHSANV 144

  Fly   151 IHRDLKPSNIAVN-EDCELRILDFGLARPTENEMT--GYVA----TRWYRAPEIMLNWMHYDQTV 208
            :||||||:||.:| |...|:|.||||||..:...:  ||::    |:|||:|.::|:..:|.:.:
Zfish   145 LHRDLKPANIFINTEQMLLKIGDFGLARIVDPHYSHKGYLSEGMVTKWYRSPRLLLSPNNYTKAI 209

  Fly   209 DIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPPMKG-- 271
            |:|:.|||:||::|.|.||.|...:.|:.||::   |.|.     |..|..:..::.:|.:.|  
Zfish   210 DMWAAGCILAEMLTGRMLFAGAHELEQMQLILD---TVPV-----IREEDRQELLRVMPSLVGHG 266

  Fly   272 ----RSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTS-PPY--DH 329
                |||:::.......|||.||.:|..:...|:|||.||..|:|::|:.|..|..| .|:  :.
Zfish   267 WQIRRSFRDLMPEVEDKAIDFLESILTFNPMDRLTAEAALCQPFLQRYSCPQDEPVSLQPFRIED 331

  Fly   330 SFED 333
            ..||
Zfish   332 ELED 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 123/329 (37%)
S_TKc 25..312 CDD:214567 115/303 (38%)
mapk4NP_998638.1 STKc_MAPK4_6 13..352 CDD:143359 123/329 (37%)
S_TKc 19..311 CDD:214567 115/303 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.