DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and nmo

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster


Alignment Length:366 Identity:151/366 - (41%)
Similarity:212/366 - (57%) Gaps:47/366 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WEIPDIYQDLQ---PVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMD 80
            ::.|.:.||:|   |:|.||:|.|...........||:|||...|||.|.:||.:|||::|....
  Fly    31 YQPPAVPQDVQPDRPIGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFK 95

  Fly    81 HENVIGLLDIFH-PHPANGSLENFQQVYLVTHLMDADLNNII-RMQHLSDDHVQFLVYQILRGLK 143
            ||||:..|||.. ||     |:.||::|::|.|:.:||:.|| ..||||.||::..:||||||||
  Fly    96 HENVLSALDILQPPH-----LDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLK 155

  Fly   144 YIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTE----NEMTGYVATRWYRAPEIMLNWMHY 204
            |:|||.::|||:||.|:.||.:|.|:|.||||||..|    ..||..|.|::||||||::...||
  Fly   156 YLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHY 220

  Fly   205 DQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPPM 269
            ...||:||||||..||:.||.||...:.:.||.||.|:||||..|.::. :.|.||:::....| 
  Fly   221 SSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITELLGTPTMEDMRH-ACEGARTHMLRRAP- 283

  Fly   270 KGRSFKNVF---KNANPLAIDLLEKMLELDAEKRITAEEALSHPYLE------------------ 313
            |..||..::   .:|...|:.||.:||..|.:|||:..:||:||||:                  
  Fly   284 KPPSFSVLYTLSSHATHEAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTS 348

  Fly   314 ----KYA---EPSVEQTSPPYDHSFEDMDLPVDKWKELIYK 347
                :|.   |||..|   |:|..:|.....|.:.||.::|
  Fly   349 AGMRQYTADFEPSAGQ---PFDDLWERKLTSVQQVKEEMHK 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 151/366 (41%)
S_TKc 25..312 CDD:214567 136/298 (46%)
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 149/358 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D34458at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.