DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and p38c

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_996277.1 Gene:p38c / 2768679 FlyBaseID:FBgn0267339 Length:356 Species:Drosophila melanogaster


Alignment Length:349 Identity:184/349 - (52%)
Similarity:251/349 - (71%) Gaps:4/349 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRE 72
            :|.::.||.:.||.||||:.::.:|.|::|||:|..:|||..:.|:|:|.|||:....||.||||
  Fly     3 EFVRVAINESLWEFPDIYEFVRFLGGGSFGQVAKVRLRGTENYFAMKRLMRPFEREEDAKGTYRE 67

  Fly    73 LRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQ 137
            :||||||:|.|||.||::||| ||:..:| |||||||||||||||:...|.:.:||..::.::||
  Fly    68 IRLLKHMNHRNVISLLNVFHP-PAHNMME-FQQVYLVTHLMDADLHRYSRSKRMSDQEIRIILYQ 130

  Fly   138 ILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAPEIMLNWM 202
            |||||||||||||:||||||.|||||.:.|:|||||||:|...::||.:|.|.||.||||:....
  Fly   131 ILRGLKYIHSAGVVHRDLKPCNIAVNGNSEVRILDFGLSRMCADKMTDHVGTMWYLAPEIIFLRG 195

  Fly   203 HYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLP 267
            .|.:.:|:||||||:|||||.|.||.|.:::.|:..::.::|||..||:..||.|.:|:|::..|
  Fly   196 QYTKAIDVWSVGCILAELITDRVLFRGENYVSQIRCLINIMGTPTREFITGISMERSRNYLEGYP 260

  Fly   268 PMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEP--SVEQTSPPYDHS 330
            ..:...|.::|...:..||||:|||||:..||||||.||:.||||....||  ..|.|:|.||.:
  Fly   261 LRQRCDFHHLFMGYDVQAIDLMEKMLEMVPEKRITAAEAMLHPYLRDLIEPHHHAEDTAPVYDQN 325

  Fly   331 FEDMDLPVDKWKELIYKEVTNFKP 354
            ||:|.|||..||||:..|:.||:|
  Fly   326 FENMVLPVKCWKELVSHEIRNFRP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 183/346 (53%)
S_TKc 25..312 CDD:214567 153/286 (53%)
p38cNP_996277.1 STKc_p38 4..349 CDD:143356 183/346 (53%)
S_TKc 20..305 CDD:214567 153/286 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442180
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 1 1.000 - - FOG0000533
OrthoInspector 1 1.000 - - mtm974
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.