DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p38a and Mapk13

DIOPT Version :9

Sequence 1:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_036080.2 Gene:Mapk13 / 26415 MGIID:1346864 Length:366 Species:Mus musculus


Alignment Length:355 Identity:207/355 - (58%)
Similarity:265/355 - (74%) Gaps:7/355 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VSITKK--FYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVH 65
            :|:|:|  |||.|||:|.||:|..|.....|||||||.|..|:.:.|...||||||:|||||.:.
Mouse     1 MSLTRKRGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPFQSEIF 65

  Fly    66 AKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDH 130
            |||.||||.|||||.|||||||||:|.|   ..||.:|...|||...|..||..|:.|: .|:|.
Mouse    66 AKRAYRELLLLKHMHHENVIGLLDVFTP---ASSLRSFHDFYLVMPFMQTDLQKIMGME-FSEDK 126

  Fly   131 VQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAP 195
            ||:||||:|:|||||||||::||||||.|:||||||||:||||||||.|:.||||||.|||||||
Mouse   127 VQYLVYQMLKGLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARHTDTEMTGYVVTRWYRAP 191

  Fly   196 EIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESAR 260
            |::|:||||:||||||||||||||::|.:|||.|.|::.||..|:::.|.|.|||::|:..::|:
Mouse   192 EVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGAEFVQKLKDKAAK 256

  Fly   261 SYIQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVE-QTS 324
            |||||||....:.|..:|..|:|.|.|||:||||||.:||:||.:||:||:.|.:.:|..| :..
Mouse   257 SYIQSLPQSPKKDFTQLFPRASPQAADLLDKMLELDVDKRLTAAQALAHPFFEPFRDPEEETEAQ 321

  Fly   325 PPYDHSFEDMDLPVDKWKELIYKEVTNFKP 354
            .|:|.:.|...|.||:||:.||||::||.|
Mouse   322 QPFDDALEHEKLSVDEWKQHIYKEISNFSP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 203/345 (59%)
S_TKc 25..312 CDD:214567 176/286 (62%)
Mapk13NP_036080.2 STKc_p38delta 9..351 CDD:143384 203/345 (59%)
S_TKc 30..308 CDD:214567 175/281 (62%)
TXY 180..182 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 1 1.000 - - FOG0000533
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X352
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.