DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kal1 and PI3

DIOPT Version :10

Sequence 1:NP_651220.3 Gene:Kal1 / 42865 FlyBaseID:FBgn0039155 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_002629.1 Gene:PI3 / 5266 HGNCID:8947 Length:117 Species:Homo sapiens


Alignment Length:56 Identity:23/56 - (41%)
Similarity:31/56 - (55%) Gaps:4/56 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QELLLGP---RAGSCPKIGRQSRARLSCLDNCQYDHECPEVQKCCPSSCGPMCVEP 139
            ||.:.||   :.||||.|..:. |.|:..:.|..|.:||.::|||..|||..|..|
Human    62 QEPVKGPVSTKPGSCPIILIRC-AMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVP 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kal1NP_651220.3 WAP 94..139 CDD:459672 18/44 (41%)
fn3 <177..245 CDD:394996
FN3 <225..>342 CDD:442628
PI3NP_002629.1 Cementoin 31..47 CDD:371104
Cementoin 55..71 CDD:371104 4/8 (50%)
WAP 72..117 CDD:197580 19/46 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.