DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Kal1 and WFDC2

DIOPT Version :9

Sequence 1:	NP_651220.3	Gene:	Kal1 / 42865	FlyBaseID:	FBgn0039155	Length:	525	Species:	Drosophila melanogaster
Sequence 2:	NP_006094.3	Gene:	WFDC2 / 10406	HGNCID:	15939	Length:	124	Species:	Homo sapiens

Alignment Length:	142	Identity:	41/142 - (28%)
Similarity:	60/142 - (42%)	Gaps:	28/142 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MGSMQVALLALLVLGQLFPSAVANGSSSYSSTSTSASNQLQRQKLAHWFRDSNDVKDKILELQCL 65
            :|.:..|||..|:   ||...:.:|:   .:..|....:||        .|.|..::.:.:.:|.
Human     6 LGPLAAALLLSLL---LFGFTLVSGT---GAEKTGVCPELQ--------ADQNCTQECVSDSECA 56

  Fly    66 --AKCGSNPTTKAGREQCLNKCIQELLLGPRAGSCPKIGRQSRARLSCLDNCQYDHECPEVQKCC 128
              .||.|     ||   |...|   .|...:.||||::.........|.|.||.|.:||...|||
Human    57 DNLKCCS-----AG---CATFC---SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCC 110

  Fly   129 PSSCGPM-CVEP 139
            .:.||.: ||.|
Human   111 RNGCGKVSCVTP 122

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Kal1	NP_651220.3	WAP	96..139	CDD:278522	18/43 (42%)
		fn3	<177..245	CDD:278470
		fn3	279..343	CDD:278470
WFDC2	NP_006094.3	WAP	32..73	CDD:365870	13/59 (22%)
WFDC2	NP_006094.3	WAP	76..123	CDD:197580	19/47 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	1	Normalized mean entropy	S7767
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.860