DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2f and AT3G44100

DIOPT Version :9

Sequence 1:NP_651219.1 Gene:Npc2f / 42864 FlyBaseID:FBgn0039154 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_189996.1 Gene:AT3G44100 / 823530 AraportID:AT3G44100 Length:152 Species:Arabidopsis thaliana


Alignment Length:108 Identity:27/108 - (25%)
Similarity:33/108 - (30%) Gaps:44/108 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 TQAAITPDP----------CDGDHGCIESASGGKAYWANIFV------------NET-LPVMKGS 146
            |...|:|||          ..|..|  |..||||.....::|            :|| .||..||
plant    40 TGVKISPDPVVSGAAATFKIFGSTG--EDISGGKVVIRVLYVGIPVHTETHDLCDETACPVAPGS 102

  Fly   147 MLWESKDA----------------NDQN---LICFQVPVVITV 170
            .:......                ||:|   |.|......|||
plant   103 FVLSHSQTLPSITPPGTYTLKMTINDKNGGRLTCISFKFKITV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2fNP_651219.1 Npc2_like 46..166 CDD:238458 24/102 (24%)
AT3G44100NP_189996.1 PG-PI_TP 27..141 CDD:238459 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.