powered by:
Protein Alignment Npc2f and AT3G11780
DIOPT Version :9
Sequence 1: | NP_651219.1 |
Gene: | Npc2f / 42864 |
FlyBaseID: | FBgn0039154 |
Length: | 170 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189862.1 |
Gene: | AT3G11780 / 820352 |
AraportID: | AT3G11780 |
Length: | 171 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 16/66 - (24%) |
Similarity: | 28/66 - (42%) |
Gaps: | 11/66 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 YQVSYLDIESCTTLPCSMARNATIKVTVRFD---DNGNGVSFLKHEVRWVFNYIKTQAAITPDPC 114
|:|....:: .|..|.:....||.:::...| .:|. |..||.:...:|.:: |.|.|
plant 36 YEVKVQGVD-ITPYPIARGEPATFRISANTDTEISSGK----LVIEVSYFGWHIHSE---THDLC 92
Fly 115 D 115
|
plant 93 D 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11306 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.