DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2f and Npc2

DIOPT Version :9

Sequence 1:NP_651219.1 Gene:Npc2f / 42864 FlyBaseID:FBgn0039154 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_075898.1 Gene:Npc2 / 67963 MGIID:1915213 Length:149 Species:Mus musculus


Alignment Length:131 Identity:33/131 - (25%)
Similarity:56/131 - (42%) Gaps:9/131 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LPFEDCGS-LYQVSYLDIESCTTLPCSMARNATIKVTVRF---DDNGNGVSFLKHEVRWVFNYIK 104
            |.|:|||| :..:..:::..|.|.||.:.:..:..|.:.|   ..:.|..:.    |..:...|:
Mouse    22 LHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQSQNSTAL----VHGILEGIR 82

  Fly   105 TQAAI-TPDPCDGDHGCIESASGGKAYWANIFVNETLPVMKGSMLWESKDANDQNLICFQVPVVI 168
            ....| .||.|.....|........:|...:.|....|.:|..:.|:.:|....||.|:::||.|
Mouse    83 VPFPIPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSIKLVVEWKLEDDKKNNLFCWEIPVQI 147

  Fly   169 T 169
            |
Mouse   148 T 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2fNP_651219.1 Npc2_like 46..166 CDD:238458 28/124 (23%)
Npc2NP_075898.1 Npc2_like 24..145 CDD:238458 28/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6567
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.920

Return to query results.
Submit another query.