DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2f and Npc2h

DIOPT Version :9

Sequence 1:NP_651219.1 Gene:Npc2f / 42864 FlyBaseID:FBgn0039154 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001247376.1 Gene:Npc2h / 43649 FlyBaseID:FBgn0039801 Length:157 Species:Drosophila melanogaster


Alignment Length:158 Identity:24/158 - (15%)
Similarity:49/158 - (31%) Gaps:49/158 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LSLRSLPFEDCGSLYQVSYLDIESCTTLPCSMARNATIKVTVRFDDNGNGVSFLKHEVRWVFNYI 103
            :|...:.|:.|..       .::||:.        :.::||...:.|.|....::...|:..::.
  Fly    19 VSAEIVNFQTCED-------SVDSCSI--------SQVRVTPCPEANANAACHIRRRHRFTMSFD 68

  Fly   104 KT----------------------------QAAITPDPCDGDHGCIESASGGKAYWANIFVNETL 140
            .|                            |.|.....|....|..::      |..|:..:...
  Fly    69 FTPHFDADTLVASLGWAKSENVELPLLTMDQEACKYTTCPVRSGVTQT------YTNNMPADARF 127

  Fly   141 PVMKGSMLWESKDANDQNLICFQVPVVI 168
            |:...::.|..||...|...||.:.:.:
  Fly   128 PLSPYTIRWALKDPVSQKRCCFTIDIKV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2fNP_651219.1 Npc2_like 46..166 CDD:238458 23/147 (16%)
Npc2hNP_001247376.1 Npc2_like 26..153 CDD:238458 23/147 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6567
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.