DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2f and Npc2e

DIOPT Version :9

Sequence 1:NP_651219.1 Gene:Npc2f / 42864 FlyBaseID:FBgn0039154 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_731439.2 Gene:Npc2e / 326136 FlyBaseID:FBgn0051410 Length:168 Species:Drosophila melanogaster


Alignment Length:124 Identity:26/124 - (20%)
Similarity:41/124 - (33%) Gaps:28/124 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LDIESCTTLPCSMARNATIKVTVRFDDNGNGVS-----------------FLKHEVRWVFNYIKT 105
            ::|:.|...||.:.:.....:.|.|..|.|.:.                 .|..||..|...: .
  Fly    32 VNIKDCEEPPCVVYKGTIAVMEVHFLGNNNNIKSITATTTAKVLGMNLPYALPDEVSDVCRNL-L 95

  Fly   106 QAAITPDPCDGDHGCIESASGGKAYWANIFVNETLPVMKGSMLWESKDANDQNLICFQV 164
            ..||.|...|.|          ..|..|.:|..:.|.:...:.....||.::.:.||.|
  Fly    96 YGAICPIDKDED----------VTYQFNFYVEPSFPEITADVTVTLNDAQNEPITCFVV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2fNP_651219.1 Npc2_like 46..166 CDD:238458 26/124 (21%)
Npc2eNP_731439.2 ML 20..144 CDD:294195 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.