DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and HRD1

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:353 Identity:68/353 - (19%)
Similarity:125/353 - (35%) Gaps:102/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 HLISDDMVVQILSHFVRYLPLIFILFFKFLHD-HLLGIVDLLVLQTVMYNVNRSVRNQVARLAQK 399
            |.|..|.:..:|........:..::|.:|..: .||.:||..::...:.::..:.::.:.  :..
Yeast   122 HWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIE--STS 184

  Fly   400 NYAVMVRDTFLVAVVVTVRLFLATSPPDPFGLIVPPSRKSVFIEVTALPFHTSSE---------- 454
            .|.:.|.: |.:.::..:.|||.|.                   :....|:.|.:          
Yeast   185 LYLIQVME-FTMLLIDLLNLFLQTC-------------------LNFWEFYRSQQSLSNENNHIV 229

  Fly   455 -GDSPT-------TSSEPIKTNMYKDTYKSLNVIPL-GMLLYYIAVSDLIIKLLTMLVKLIITML 510
             || ||       ..|:|:..:...|.........| |..:|.        |.:.:..:.:.|.|
Yeast   230 HGD-PTDENTVESDQSQPVLNDDDDDDDDDRQFTGLEGKFMYE--------KAIDVFTRFLKTAL 285

  Fly   511 PHHLMRLKVRARLYVLVEYISQFYRAMTPITQW-LLFLYESYSGLEVVSGGLFSAMYLGAKIFEL 574
             |..|.:..|..:.:|.:.:            | :|.||:|                 |..::::
Yeast   286 -HLSMLIPFRMPMMLLKDVV------------WDILALYQS-----------------GTSLWKI 320

  Fly   575 VERGKSLKKAIVTFRKNIDSERPPTKDELDAAGALCPICHDAF-------------NTPTVLECG 626
            ....|.|...:||.  .::..:....|:     .:|.||.|..             ..|..|.||
Yeast   321 WRNNKQLDDTLVTV--TVEQLQNSANDD-----NICIICMDELIHSPNQQTWKNKNKKPKRLPCG 378

  Fly   627 HIFCDECVQTWFKREQTCPMCRAKVSDD 654
            ||....|::.|.:|.||||:||..|.|:
Yeast   379 HILHLSCLKNWMERSQTCPICRLPVFDE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 19/53 (36%)
HRD1NP_014630.1 HRD1 5..551 CDD:227568 68/353 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.