DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and SAN1

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_010427.3 Gene:SAN1 / 851721 SGDID:S000002550 Length:610 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:30/159 - (18%)
Similarity:46/159 - (28%) Gaps:89/159 - (55%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 AIVTFRKNIDSERPPTKDELD------------AAGALCPICHDAF------------------- 617
            |:..|.:.::..:..:|||.|            |.|.||.||:|.:                   
Yeast   127 AMERFNRLLNRPKGISKDEFDKLPVLQVSDLPKAEGPLCSICYDEYEDEVDSTKAKRKRDSENEE 191

  Fly   618 ----------------------------------------------------------NTPTVLE 624
                                                                      ::|..|.
Yeast   192 ESEGTKKRKDNEGAPLRTTADNDSNPSITNATVVEPPSIPLTEQQRTLNDEETNPSYKHSPIKLP 256

  Fly   625 CGHIFCDECVQTWFKREQTCPMCRAKVSD 653
            |||||..||:..|.:.|.:||:||.|:|:
Yeast   257 CGHIFGRECIYKWSRLENSCPLCRQKISE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 19/117 (16%)
SAN1NP_010427.3 HRD1 <242..424 CDD:227568 17/44 (39%)
zf-RING_2 <251..280 CDD:404518 13/28 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.