powered by:
Protein Alignment CG13605 and RAD18
DIOPT Version :9
Sequence 1: | NP_651214.2 |
Gene: | CG13605 / 42858 |
FlyBaseID: | FBgn0039150 |
Length: | 669 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009992.1 |
Gene: | RAD18 / 850430 |
SGDID: | S000000662 |
Length: | 487 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 62 |
Identity: | 19/62 - (30%) |
Similarity: | 29/62 - (46%) |
Gaps: | 1/62 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 586 VTFRKNIDSERPPTKDELDAAGALCPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCPMC 647
:|...:..:...|:..:||.. ..|.||.|....|.:..|||.||..|::|....:..||:|
Yeast 5 ITTASDFTTTSIPSLYQLDTL-LRCHICKDFLKVPVLTPCGHTFCSLCIRTHLNNQPNCPLC 65
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13605 | NP_651214.2 |
RING |
610..651 |
CDD:238093 |
15/38 (39%) |
RAD18 | NP_009992.1 |
RAD18 |
1..470 |
CDD:227719 |
19/62 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.