DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and RAD18

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_009992.1 Gene:RAD18 / 850430 SGDID:S000000662 Length:487 Species:Saccharomyces cerevisiae


Alignment Length:62 Identity:19/62 - (30%)
Similarity:29/62 - (46%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 VTFRKNIDSERPPTKDELDAAGALCPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCPMC 647
            :|...:..:...|:..:||.. ..|.||.|....|.:..|||.||..|::|....:..||:|
Yeast     5 ITTASDFTTTSIPSLYQLDTL-LRCHICKDFLKVPVLTPCGHTFCSLCIRTHLNNQPNCPLC 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 15/38 (39%)
RAD18NP_009992.1 RAD18 1..470 CDD:227719 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.