DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and SYVN1

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_757385.1 Gene:SYVN1 / 84447 HGNCID:20738 Length:617 Species:Homo sapiens


Alignment Length:328 Identity:69/328 - (21%)
Similarity:120/328 - (36%) Gaps:123/328 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 HLISDDMV--------VQILSHFVRYLPLIFILFFKFLHDHLLGIVDLLVLQTVMYNVNRSVRNQ 392
            |.:::|.|        :..|.| .|.:.|:|          ||||:|.|.:....:::       
Human   117 HWLAEDRVDFMERSPNISWLFH-CRIVSLMF----------LLGILDFLFVSHAYHSI------- 163

  Fly   393 VARLAQKNYAVMVRDTFLVAVVVTVRLFLATSPPDPFGLIVPPSRKSVFIEVTALPFHTSSEGDS 457
                ..:..:|.:...|..|:::|:.|                   ::||:.........||  :
Human   164 ----LTRGASVQLVFGFEYAILMTMVL-------------------TIFIKYVLHSVDLQSE--N 203

  Fly   458 PTTSSEPIKTNMYKDTYKSLNVIPLGMLLYYIAVSDLIIKLLTMLVKLIITMLPHHLMRLKVRAR 522
            |..:.                           ||..|..:|.|..:|:::.|.   .|.:.::..
Human   204 PWDNK---------------------------AVYMLYTELFTGFIKVLLYMA---FMTIMIKVH 238

  Fly   523 LYVLVEYISQFYRAMTPITQWLLFLYESYSGLEVVSGGLFSAMYLGAKIFELVERGKSLKKAIVT 587
            .:.|.        |:.|                         |||..:.|:     |::..||::
Human   239 TFPLF--------AIRP-------------------------MYLAMRQFK-----KAVTDAIMS 265

  Fly   588 FR--KNIDSERP-PTKDELDAAGALCPICHDAFNTPTV-LECGHIFCDECVQTWFKREQTCPMCR 648
            .|  :|:::..| .|.:||.|...:|.||.:...|... |.|.|||...|:::||:|:||||.||
Human   266 RRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCR 330

  Fly   649 AKV 651
            ..|
Human   331 MDV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 19/41 (46%)
SYVN1NP_757385.1 Involved in FAM8A1 interaction. /evidence=ECO:0000269|PubMed:28827405 1..251 37/239 (15%)
Necessary and sufficient for SEL1L interaction. /evidence=ECO:0000269|PubMed:28827405 1..84
HRD1 10..>333 CDD:227568 68/326 (21%)
Interaction with p53/TP53. /evidence=ECO:0000269|PubMed:17170702 236..270 11/71 (15%)
zf-RING_2 289..330 CDD:290367 17/40 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 337..375
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..453
HAF-H domain, necessary to form higher-order Hrd1 complexes. /evidence=ECO:0000303|PubMed:28827405 480..535
Nha1_C <528..611 CDD:285783
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 535..617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.