DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and Hrd1B

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_849843.3 Gene:Hrd1B / 842812 AraportID:AT1G65040 Length:460 Species:Arabidopsis thaliana


Alignment Length:339 Identity:74/339 - (21%)
Similarity:129/339 - (38%) Gaps:99/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 LVLQTVMYNVNR-----SVRN-QVARLAQKNYAVMVRDTF------------LVAVVVTVRLFLA 422
            |||...::|:.:     |:|. :|.||.::.:..::...|            .:::|||:.|.. 
plant    51 LVLMLSLWNLVKIVFLGSLREAEVERLNEQAWRELMEILFAITIFRQDFSVGFISLVVTLLLIK- 114

  Fly   423 TSPPDPFGLIVPPSRKSVFIEVTALPFHTSSEGDSPTTSSEPIKTNMYKDTYKSLNVIPLGMLLY 487
                   ||.....::..:||.|                                   |...||.
plant   115 -------GLHWMAQKRVEYIETT-----------------------------------PSVTLLS 137

  Fly   488 YIAVSDLIIKLLTMLVKLIITMLPHHLMRLKVRARLYVLVEYISQFYRAMTPITQWLLF------ 546
            ::.:...::.||.:...|..:.:...:...|....::...||:......::.|.::..:      
plant   138 HVRIVSFMVFLLILDCLLTYSSIQQLIQSRKASMSVFFTFEYMILATTTVSIIVKYAFYVTDMLK 202

  Fly   547 --------LYESYSGLEVVSGGLFSAMYL----------GAK---IFELVERGKSLKKAI---VT 587
                    :|..|  ||:|...|..:|||          |..   |.||.|..::.|..:   :.
plant   203 EGQWEGKPVYTFY--LELVRDLLHLSMYLCFFLMIFMNYGLPLHLIRELYETFRNFKIRVTDYLR 265

  Fly   588 FRK---NIDSERP-PTKDELDAAGALCPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCPMCR 648
            :||   |::...| .|.:||.:..|.|.||.:...:...|.|||:|...|:::|.:|:.|||.||
plant   266 YRKITSNMNDRFPDATPEELSSNDATCIICREEMTSAKKLVCGHLFHVHCLRSWLERQNTCPTCR 330

  Fly   649 AKVSDDPAWQDGST 662
            |.|.  ||....||
plant   331 ALVV--PAENATST 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 17/40 (43%)
Hrd1BNP_849843.3 HRD1 9..386 CDD:227568 74/339 (22%)
zf-RING_2 291..330 CDD:290367 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.