DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and Hrd1A

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_188230.1 Gene:Hrd1A / 820854 AraportID:AT3G16090 Length:492 Species:Arabidopsis thaliana


Alignment Length:316 Identity:70/316 - (22%)
Similarity:110/316 - (34%) Gaps:123/316 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 VQILSHFVRYLPLIFILFFKFLHDHLLGIVDLLVLQTVMYNVNRSVRNQVARLAQKNYAVMVRDT 408
            |..||||      ..:.|..||         |||....||:   |:|:.: :..|.:.::.....
plant   133 VSKLSHF------RIVSFMGFL---------LLVDSLFMYS---SIRHLI-QSRQASVSLFFSFE 178

  Fly   409 FLVAVVVTVRLFLATSPPDPFGLIVPPSRKSVFIEVTALPFHTSSEGDSPTTSSEPIKTNMYKDT 473
            :::....||.:|:                |.||.....|     .:|.   ...:|:.|      
plant   179 YMILATTTVAIFV----------------KYVFYVTDML-----MDGQ---WEKKPVYT------ 213

  Fly   474 YKSLNVIPLGMLLYYIAVSDLIIKLLTMLVKLIITM---LPHHLMRLKVRARLYVLVEYISQFYR 535
                        .|...:.||:...:.:....:|.|   :|.||:|                   
plant   214 ------------FYLELIRDLLHLSMYICFFFVIFMNYGVPLHLLR------------------- 247

  Fly   536 AMTPITQWLLFLYESYSGLEV-VSGGLFSAMYLGAKIFELVERGKSLKKAIVTFRK---NIDSER 596
                      .|||::...:: ||.      ||                   .:||   |::...
plant   248 ----------ELYETFRNFQIRVSD------YL-------------------RYRKITSNMNDRF 277

  Fly   597 P-PTKDELDAAGALCPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCPMCRAKV 651
            | .|.:||.|:.|.|.||.:.......|.|||:|...|:::|.:|:||||.|||.|
plant   278 PDATPEELTASDATCIICREEMTNAKKLICGHLFHVHCLRSWLERQQTCPTCRALV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 18/40 (45%)
Hrd1ANP_188230.1 HRD1 3..386 CDD:227568 70/316 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.