powered by:
Protein Alignment CG13605 and Trim69
DIOPT Version :9
Sequence 1: | NP_651214.2 |
Gene: | CG13605 / 42858 |
FlyBaseID: | FBgn0039150 |
Length: | 669 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_536771.2 |
Gene: | Trim69 / 70928 |
MGIID: | 1918178 |
Length: | 500 |
Species: | Mus musculus |
Alignment Length: | 42 |
Identity: | 19/42 - (45%) |
Similarity: | 29/42 - (69%) |
Gaps: | 3/42 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 610 CPICHDAFNTPTVLECGHIFCDECVQTWFK---REQTCPMCR 648
||:|:|.|..|.:|.|||.||.:|:|:::| :|..||.|:
Mouse 42 CPLCNDWFRDPLMLTCGHNFCQDCIQSFWKVHSKETFCPDCK 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S6049 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.