DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and Trim69

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_536771.2 Gene:Trim69 / 70928 MGIID:1918178 Length:500 Species:Mus musculus


Alignment Length:42 Identity:19/42 - (45%)
Similarity:29/42 - (69%) Gaps:3/42 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 CPICHDAFNTPTVLECGHIFCDECVQTWFK---REQTCPMCR 648
            ||:|:|.|..|.:|.|||.||.:|:|:::|   :|..||.|:
Mouse    42 CPLCNDWFRDPLMLTCGHNFCQDCIQSFWKVHSKETFCPDCK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 19/42 (45%)
Trim69NP_536771.2 Necessary for nuclear localization 1..153 19/42 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
RING 42..82 CDD:302633 18/39 (46%)
SPRY 312..497 CDD:295394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6049
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.