DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and rnf145a

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_005157379.1 Gene:rnf145a / 565986 ZFINID:ZDB-GENE-111012-3 Length:649 Species:Danio rerio


Alignment Length:359 Identity:70/359 - (19%)
Similarity:130/359 - (36%) Gaps:97/359 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 LPLIFILFFKFLHDHLLGIVDLLVLQTVMY-------NVNRSVRNQVARLAQKNYAVMVRDTFLV 411
            |.|:|.:.|.     .||::.|.......|       .::|.:...:..|      ::...|.|:
Zfish   278 LGLVFTVSFV-----ALGVLTLCKFYLQGYRAFMNDNTMHRGMTEGITLL------ILAVQTGLI 331

  Fly   412 AVVVTVRLFLATSPPDPFGLIVPPSRKSVFIEVTALPFHTSSEGDSPTTSSEPI----KTNMYKD 472
            .:.|..|.||.:        |:      :||.|.::.       .|....::||    ..:..|.
Zfish   332 ELQVIHRAFLLS--------II------LFIVVASIL-------QSMLEIADPIVLALGASRDKS 375

  Fly   473 TYKSLNVIP--LGMLLYYIAVSDLIIKLLTMLVKLIITMLPHHLMRLKVRARLYVLVEYISQFYR 535
            .:|....:.  |.:|::...:|.:|.:...|...|:|.:....|..|:|...|.:.|.::.:..|
Zfish   376 LWKHFRAVSLCLFLLVFPAYMSYMICQFFHMDFWLLIIISSSILTSLQVLGTLLIYVLFMVEELR 440

  Fly   536 A-----MTPITQWLLFLY---ESYSGLEVVSGGLFSAMY------------------------LG 568
            .     |..:..|:...|   |....|.||:.|:...::                        ||
Zfish   441 KAPVENMDDVIYWVNGTYRLLEFLVALCVVAYGVSETVFGEWTVMGSTIVLIHSYYNVWLRAQLG 505

  Fly   569 AKIF----ELVERGKSLKKAIVTFRKNIDSERPPTKDELDAAGALCPICHDAFNTPTVLECGHIF 629
            .:.|    :.|.:.|||..|              :..:|.....:|.||:....:..:..|.|:|
Zfish   506 WQSFLLRRDAVNKIKSLPTA--------------SLQQLQQHNDICSICYQDMTSAVITPCSHLF 556

  Fly   630 CDECVQTWFKREQTCPMCRAKVSDDPAWQDGSTT 663
            ...|::.|...::|||:|..::....  |.||::
Zfish   557 HAGCLKKWLYVQETCPLCHNQLKGSS--QLGSSS 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 12/40 (30%)
rnf145aXP_005157379.1 TRC8_N 8..506 CDD:290425 47/259 (18%)
zf-RING_2 535..575 CDD:290367 11/39 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.