DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and amfra

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_998328.2 Gene:amfra / 406442 ZFINID:ZDB-GENE-040426-2190 Length:620 Species:Danio rerio


Alignment Length:168 Identity:39/168 - (23%)
Similarity:71/168 - (42%) Gaps:43/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 YIAVSDLIIKLLTMLVKLIITMLPHHLMRLKVRARLYVLVEYISQFYRAMTPITQWLLF--LYES 550
            ||..:|.|::|..:.:.|:     ||:                           ..|||  ::.|
Zfish   249 YIYYTDFIMELAILSLDLM-----HHI---------------------------HMLLFGNIWLS 281

  Fly   551 YSGLEVVSGGLFSAMYLGAKIFELVERGKSLKKAIVTFRKNIDSE-RPPTKDELDAAGALCPICH 614
            .:.|.:    .....:|..::...:.|.|:..:.|    .|::|. ...|.:||.|....|.||.
Zfish   282 MASLVI----FMQLRHLFHEVQRRIRRHKNYLRVI----DNMESRFAVATPEELAANNDDCAICW 338

  Fly   615 DAFNTPTVLECGHIFCDECVQTWFKREQTCPMCRAKVS 652
            |:..|...|.|||:|.:.|:::|.:::.:||.||..::
Zfish   339 DSMTTARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLN 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 16/40 (40%)
amfraNP_998328.2 zf-rbx1 79..>375 CDD:331150 39/165 (24%)
RING-H2_AMFR 332..375 CDD:319369 16/42 (38%)
RING-H2 finger (C3H2C3-type) 334..371 CDD:319369 14/36 (39%)
CUE_AMFR 451..491 CDD:270604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.