DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and Syvn1

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_006230914.1 Gene:Syvn1 / 361712 RGDID:1310488 Length:612 Species:Rattus norvegicus


Alignment Length:328 Identity:69/328 - (21%)
Similarity:120/328 - (36%) Gaps:123/328 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 HLISDDMV--------VQILSHFVRYLPLIFILFFKFLHDHLLGIVDLLVLQTVMYNVNRSVRNQ 392
            |.:::|.|        :..|.| .|.:.|:|          ||||:|.|.:....:::       
  Rat   117 HWLAEDRVDFMERSPNISWLFH-CRIVSLMF----------LLGILDFLFVSHAYHSI------- 163

  Fly   393 VARLAQKNYAVMVRDTFLVAVVVTVRLFLATSPPDPFGLIVPPSRKSVFIEVTALPFHTSSEGDS 457
                ..:..:|.:...|..|:::|:.|                   ::||:.........||  :
  Rat   164 ----LTRGASVQLVFGFEYAILMTMVL-------------------TIFIKYVLHSVDLQSE--N 203

  Fly   458 PTTSSEPIKTNMYKDTYKSLNVIPLGMLLYYIAVSDLIIKLLTMLVKLIITMLPHHLMRLKVRAR 522
            |..:.                           ||..|..:|.|..:|:::.|.   .|.:.::..
  Rat   204 PWDNK---------------------------AVYMLYTELFTGFIKVLLYMA---FMTIMIKVH 238

  Fly   523 LYVLVEYISQFYRAMTPITQWLLFLYESYSGLEVVSGGLFSAMYLGAKIFELVERGKSLKKAIVT 587
            .:.|.        |:.|                         |||..:.|:     |::..||::
  Rat   239 TFPLF--------AIRP-------------------------MYLAMRQFK-----KAVTDAIMS 265

  Fly   588 FR--KNIDSERP-PTKDELDAAGALCPICHDAFNTPTV-LECGHIFCDECVQTWFKREQTCPMCR 648
            .|  :|:::..| .|.:||.|...:|.||.:...|... |.|.|||...|:::||:|:||||.||
  Rat   266 RRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCR 330

  Fly   649 AKV 651
            ..|
  Rat   331 MDV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 19/41 (46%)
Syvn1XP_006230914.1 HRD1 10..>333 CDD:227568 68/326 (21%)
fibronec_FbpA <524..>597 CDD:411474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.