DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and Amfr

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_038954087.1 Gene:Amfr / 361367 RGDID:1311551 Length:643 Species:Rattus norvegicus


Alignment Length:182 Identity:39/182 - (21%)
Similarity:75/182 - (41%) Gaps:50/182 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 GMLLYYIAVSDLIIKLLTMLVKLIITMLPHHLMRLKVRARLYVLVEYISQFYRAMTPITQWLLF- 546
            |..:||   :|.:::|:.:.:.|:     ||:                           ..||| 
  Rat   254 GTYVYY---TDFVMELMLLSLDLM-----HHI---------------------------HMLLFG 283

  Fly   547 -LYESYSGLEVVSGGLFSAMYLGAKIFELVERGKSLKKAIVTFRKNIDSE-RPPTKDELDAAGAL 609
             ::.|.:.|.:    .....||..::...:.|.|:..:.:    .|:::. ...|.:||......
  Rat   284 NIWLSMASLVI----FMQLRYLFHEVQRRIRRHKNYLRVV----GNMEARFAVATAEELAVNNDD 340

  Fly   610 CPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCPMCRAKVSDDPAWQDGS 661
            |.||.|:......|.|||:|.:.|:::|.:::.:||.||..::    ..|||
  Rat   341 CAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLN----IADGS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 15/40 (38%)
AmfrXP_038954087.1 HRD1 86..>382 CDD:227568 36/170 (21%)
RING-H2_AMFR 339..382 CDD:319369 15/42 (36%)
CUE_AMFR 458..498 CDD:270604
G2BR 575..600 CDD:375868
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.