DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and Rnf139

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001121017.1 Gene:Rnf139 / 315000 RGDID:1306670 Length:656 Species:Rattus norvegicus


Alignment Length:356 Identity:73/356 - (20%)
Similarity:130/356 - (36%) Gaps:93/356 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 ILSHFVRYLPLIFILFFKFLH--DHLLGIVD-----LLVLQTVMYNVNRSVRNQVARLAQKNYAV 403
            ::|....||.|..:.|.....  |..||.|.     :|.|||.:..:....|  :.||::.    
  Rat   285 VISSIAHYLGLGILAFIGSTEEDDRRLGFVAPVLFFILALQTGLSGLRPEER--LIRLSRN---- 343

  Fly   404 MVRDTFLVAVVVTVRLFLATSPPDPFGLIVPPSRKSVF------IEVTALPFHTSSEGDSPTTSS 462
                   :.:::|..|.......||..:.:..|..|.|      :.|:|..|             
  Rat   344 -------MCLLLTAVLHFIHGMTDPVLMSLSASHVSSFHRHFPVLFVSACLF------------- 388

  Fly   463 EPIKTNMYKDTYKSLNVIPLGMLLYYI-----AVSDLIIKLLTMLVKLIITMLPHHLMRLKVRAR 522
                            ::|  :||.|:     |::..:..:....|:|.:.::        |...
  Rat   389 ----------------ILP--VLLSYVLWHHYALNTWLFAVTAFCVELCLKVI--------VSLT 427

  Fly   523 LYVLVEYISQFYRAM-TPITQWLLFLYESYSGLEVVSG------GLFSAMY-LGAKI-------- 571
            :|.|. .|..:|..: ..:..::.|:..:.:.:|.:.|      |.::.|: .|:||        
  Rat   428 VYTLF-MIDGYYNVLWEKLDDYVYFVRSTGNIIEFIFGVVMFGNGAYTMMFESGSKIRACMMCLH 491

  Fly   572 --FELVERGKSLKKAIVTFR---KNIDSERPPTKDELDAAGALCPICHDAFNTPT-VLECGHIFC 630
              |.:..:.|:..|..:..|   |.|:|........|.....:|.||:..|.|.. :..|.|.|.
  Rat   492 AYFNIYLQVKNGWKTFMNRRTAVKKINSLPEIKGSHLQEIDDVCAICYHEFTTSARITPCNHYFH 556

  Fly   631 DECVQTWFKREQTCPMCRAKVSDDPAWQDGS 661
            ..|::.|...:.|||||..||..:...:|.|
  Rat   557 ALCLRKWLYIQDTCPMCHQKVYIEDDIKDNS 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 15/41 (37%)
Rnf139NP_001121017.1 TRC8_N 7..504 CDD:290425 48/271 (18%)
zf-rbx1 <532..574 CDD:289448 14/41 (34%)
RING 535..577 CDD:238093 15/41 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.