DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and AMFR

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001310441.1 Gene:AMFR / 267 HGNCID:463 Length:675 Species:Homo sapiens


Alignment Length:184 Identity:41/184 - (22%)
Similarity:81/184 - (44%) Gaps:33/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 LYYIAVSDLIIKLLT--MLVKLIITMLPHHLMRLKVRAR-----LYVLVEYISQFYRAMTPIT-- 541
            |.::|...|::.:.|  ::::.:|     ||..|.....     .||   |.:.|...:|.::  
Human   216 LAFMAAESLLVTVRTAHVILRYVI-----HLWDLNHEGTWEGKGTYV---YYTDFVMELTLLSLD 272

  Fly   542 -----QWLLF--LYESYSGLEVVSGGLFSAMYLGAKIFELVERGKSLKKAIVTFRKNIDSE-RPP 598
                 ..|||  ::.|.:.|.:    .....||..::...:.|.|:..:.:    .|:::. ...
Human   273 LMHHIHMLLFGNIWLSMASLVI----FMQLRYLFHEVQRRIRRHKNYLRVV----GNMEARFAVA 329

  Fly   599 TKDELDAAGALCPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCPMCRAKVS 652
            |.:||......|.||.|:......|.|||:|.:.|:::|.:::.:||.||..::
Human   330 TPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLN 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 15/40 (38%)
AMFRNP_001310441.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.