DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and Amfr

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_035917.2 Gene:Amfr / 23802 MGIID:1345634 Length:639 Species:Mus musculus


Alignment Length:414 Identity:81/414 - (19%)
Similarity:149/414 - (35%) Gaps:137/414 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 ENGGGGGNPPEP--AENNPE-------------DEHLISDDMVVQILSHFVRYLPLIFILFFKFL 365
            |:|.|   .|||  |...||             .::|:||.:.|.:|   |.....:.:|..|  
Mouse    40 EDGSG---EPEPLTAPLQPEARLTAGGPRARDVAQYLLSDSLFVWVL---VNTACCVLMLVAK-- 96

  Fly   366 HDHLLGIVDLLVLQTVMYNVNRSVRNQVARLAQKNYAVMVRDTFLVAV--VVTVR------LFLA 422
                       ::|.:::...|....|..:....|: :..:..|:..|  |.||.      |:.|
Mouse    97 -----------LIQCIVFGPLRVSERQHLKDKFWNF-IFYKFIFIFGVLNVQTVEEVVMWCLWFA 149

  Fly   423 TSPPDPFGLIVPPSRKSVFIEVTALPFHTSSEGDSPTTSSEPIKTNMYKDTYKSLNVIPLGMLLY 487
                   ||        ||:.                     :...:.||.::.|:..|...:..
Mouse   150 -------GL--------VFLH---------------------LMVQLCKDRFEYLSFSPTTPMSS 178

  Fly   488 YIAVSDLIIKLLT----MLVKLIITMLPHHLMRLKVRARLYVLVEYISQFYRAMTPITQWLLFLY 548
            :..|..|:|.:|.    :.|...:|...|.:..|...|...:||.     .|....|.::::.|:
Mouse   179 HGRVLSLLIAMLLSCCGLAVVCCVTGYTHGMHTLAFMAAESLLVT-----VRTAHVILRYVIHLW 238

  Fly   549 E-----SYSG-------------LEVVS------------GGLFSAM----------YLGAKIFE 573
            :     ::.|             |.::|            |.::.:|          ||..::..
Mouse   239 DLNHEGTWEGKGTYVYYTDFVMELALLSLDLMHHIHMLLFGNIWLSMASLVIFMQLRYLFHEVQR 303

  Fly   574 LVERGKSLKKAIVTFRKNIDSE-RPPTKDELDAAGALCPICHDAFNTPTVLECGHIFCDECVQTW 637
            .:.|.|:..:.:    .|:::. ...|.:||......|.||.|:......|.|||:|.:.|:::|
Mouse   304 RIRRHKNYLRVV----GNMEARFAVATPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSCLRSW 364

  Fly   638 FKREQTCPMCRAKVSDDPAWQDGS 661
            .:::.:||.||..::    ..|||
Mouse   365 LEQDTSCPTCRMSLN----IADGS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 15/40 (38%)
AmfrNP_035917.2 HRD1 82..>378 CDD:227568 65/357 (18%)
zf-RING_2 335..375 CDD:290367 13/39 (33%)
CUE_AMFR 454..494 CDD:270604
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..620
VCP/p97-interacting motif (VIM). /evidence=ECO:0000250|UniProtKB:Q9UKV5 618..636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.