DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and Chfr

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001276506.1 Gene:Chfr / 231600 MGIID:2444898 Length:664 Species:Mus musculus


Alignment Length:59 Identity:20/59 - (33%)
Similarity:25/59 - (42%) Gaps:5/59 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 SERPPTKDELDAAGALCPICHDAFNTPTVLE-CGHIFCDECVQTWFKREQTCPMCRAKV 651
            |.:|...:|.    ..|.||.|..:....|: |.|.||..|...|.:|...||.||..|
Mouse   291 SVKPDKMEET----LTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 16/41 (39%)
ChfrNP_001276506.1 FHA 16..105 CDD:238017
FHA <27..140 CDD:224630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..220
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..264
RING 302..345 CDD:238093 16/42 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.