DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and R02E12.4

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001352248.1 Gene:R02E12.4 / 187525 WormBaseID:WBGene00019828 Length:400 Species:Caenorhabditis elegans


Alignment Length:91 Identity:21/91 - (23%)
Similarity:31/91 - (34%) Gaps:32/91 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 LEVVSGGLFSAMYLGAKIFELVERGKSLKKAIVTFRKNIDSERPPTKDELDAAGALCPICHDAFN 618
            |.|....:.:|...|....:|::|.|.||    .:...||.|....|:|           ||   
 Worm    19 LAVKEANMRAARMQGQTTQQLMQRVKDLK----YWSGEIDRELADVKEE-----------HD--- 65

  Fly   619 TPTVLECGHIFCDECVQTWFKREQTC 644
              .:|.|            ::|.|.|
 Worm    66 --DLLRC------------YRRLQLC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 7/35 (20%)
R02E12.4NP_001352248.1 Tektin 12..380 CDD:308655 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.