DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and rnf-145

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_491382.2 Gene:rnf-145 / 172053 WormBaseID:WBGene00022471 Length:742 Species:Caenorhabditis elegans


Alignment Length:324 Identity:60/324 - (18%)
Similarity:104/324 - (32%) Gaps:106/324 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 LPLIFILFFKFLHDHLLGIVDLLVLQTVMYNVNRSVRNQVARLAQKNYAVMVRDTFLVAVVVTVR 418
            |.|:..:....|...|..|:::::|     |:..|.....||.|:   .:.:....:|....|.:
 Worm   397 LALVLYIVISALLQSLFEIIEVVLL-----NLPSSPTASRARHAR---CICIALLLVVIPFFTTK 453

  Fly   419 LFLATSPPDPFGLIVPPSRKS-------VFIEVTALPFHTSSEGDSPTTSSEPIKTNMYKDTYKS 476
            ..||..|.|.:..|:..:..:       |.::...|...|.||        ||.:          
 Worm   454 TMLALLPIDIYTAIIIANSATVTARAIGVILKYIVLIVETKSE--------EPWE---------- 500

  Fly   477 LNVIPLGMLLYYIAVSDLIIKLLT----------MLVKLIITMLPHHLMRLKVRARLYVLVEYIS 531
                .:..|.|||..::..|:||.          .:||:..:.....::...|...:|..:|:..
 Worm   501 ----GIDDLTYYIDCANKGIELLAAKVVMVFGCMQVVKVGFSFATFAILLFHVIVNIYKRLEHTV 561

  Fly   532 QFYRAMTPITQWLLFLYESYSGLEVVSGGLFSAMYLGAKIFELVERGKSLKKA-IVTFRKNIDSE 595
            .|.:...                                  ..|:....|.|| :|..|:..|  
 Worm   562 SFIKNRN----------------------------------AAVKNINRLSKADVVQLRERED-- 590

  Fly   596 RPPTKDELDAAGALCPIC-----HDAFNTPTVLECGHIFCDECVQTWFKREQTCPMCRAKVSDD 654
                         :|.||     .:|..||    |.|.|...|::.|...:..||:|...:.:|
 Worm   591 -------------VCAICFIEMKEEARITP----CKHYFHGPCLRKWLAVKMVCPLCYTYMKED 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 14/45 (31%)
rnf-145NP_491382.2 TRC8_N 49..556 CDD:372682 36/188 (19%)
RING-H2_RNF139_like 590..631 CDD:319390 14/59 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.