DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and amfrb

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_005169066.1 Gene:amfrb / 101884807 ZFINID:ZDB-GENE-130530-643 Length:459 Species:Danio rerio


Alignment Length:175 Identity:37/175 - (21%)
Similarity:71/175 - (40%) Gaps:52/175 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 MLLYYIAVSDLIIKLLTMLVKLIITMLPHHLMRLKVRARLY------VLVEYISQFYRAMTPITQ 542
            :.:||   :|.::::..:|:.::     ||:..|     ||      |...:|....|.:....|
Zfish   247 VFIYY---TDFVMEMGILLLDMM-----HHINML-----LYGNVWFSVADLFILTHIRFLAKEMQ 298

  Fly   543 WLLFLYESYSGLEVVSGGLFSAMYLGAKIFELVERGKSLKKAIVTFRKNIDSERPPTKDELDAAG 607
            ..||.:::|                 ..|:::::...|:                .|.:||.:..
Zfish   299 RKLFQHKNY-----------------MHIYDVMDTRFSM----------------ATMEELASRD 330

  Fly   608 ALCPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCPMCRAKVS 652
            ..|.||.:...|...|.|||:|...|:::|.::..:||.||..|:
Zfish   331 DRCVICWEKMYTAYKLPCGHLFHKSCLRSWLEQNMSCPTCRMSVN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 15/40 (38%)
amfrbXP_005169066.1 HRD1 77..>403 CDD:227568 37/175 (21%)
zf-RING_2 331..371 CDD:290367 13/39 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.