DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and rnf139

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001116520.1 Gene:rnf139 / 100144552 ZFINID:ZDB-GENE-080401-4 Length:664 Species:Danio rerio


Alignment Length:345 Identity:68/345 - (19%)
Similarity:130/345 - (37%) Gaps:83/345 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 ILSHFVRYLPLIFILFFKFL--HDHLLGIVD-----LLVLQTVMYNVNRSVRNQVARLAQKNYAV 403
            ::|....||.|..:.|....  .|..||.|.     :|.|||.:..::...|  :.||::.    
Zfish   287 VISSLAHYLGLSILAFIGSTEEEDKRLGFVAPVLFFILALQTGLSGLDPEER--LVRLSRN---- 345

  Fly   404 MVRDTFLVAVVVTVRLFLATSPPDPFGLIVPPS-----RKSVFIEVTALPFHTSSEGDSPTTSSE 463
                   :.:::|..|.......||..:.:..|     |:.|.:.:.:|...|            
Zfish   346 -------MCLLLTAILHFIHGMTDPVLMSLSASHVSSVRRHVPVLLVSLVLFT------------ 391

  Fly   464 PIKTNMYKDTYKSLNVIPLGMLLYYIAVSDLIIKLLTMLVKLIITMLPHHLMRLKVRARLYVLVE 528
                         |.|:...:|.::.|::..:..:....::|.:.:|        |...:|.|. 
Zfish   392 -------------LPVLLSFLLWHHYALNTWLFAVTAFCIELCLKVL--------VSLTVYALF- 434

  Fly   529 YISQFYRAM-TPITQWLLFLYESYSGLEVVSG------GLFSAMY-LGAKI----------FELV 575
            .:..||..: ..:..::.::..:.:.:|.:.|      |.::.|: .|:||          |.:.
Zfish   435 MMDGFYNVLWEKLDDYVYYVRSTGNVIEFIFGVIMFGNGAYTMMFESGSKIRACMMCLHAYFNIY 499

  Fly   576 ERGKSLKKAIVTFR---KNIDSERPPTKDELDAAGALCPICHDAF-NTPTVLECGHIFCDECVQT 636
            .:.|:..|..:..|   |.|:|........|.....:|.||:..| ::..:..|.|.|...|::.
Zfish   500 LQAKNGWKTFINRRTAVKKINSLPEVRGSRLRDIEDVCAICYQEFGSSARITPCSHYFHALCLRK 564

  Fly   637 WFKREQTCPMC--RAKVSDD 654
            |...:.|||||  |..:.||
Zfish   565 WLYIQDTCPMCHQRVYIEDD 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 15/43 (35%)
rnf139NP_001116520.1 TRC8_N 13..506 CDD:290425 45/265 (17%)
zf-rbx1 516..576 CDD:289448 17/59 (29%)
RING 537..579 CDD:238093 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.