DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and rnf145l

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001106467.1 Gene:rnf145l / 100127651 XenbaseID:XB-GENE-5921670 Length:679 Species:Xenopus tropicalis


Alignment Length:351 Identity:74/351 - (21%)
Similarity:133/351 - (37%) Gaps:98/351 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 LSHFVRYLPLIFILFFKFLHDHLLGI------------------VDLLVLQTVMYNVNRSVRNQV 393
            |:..|.||.|..:.|.||   :|||.                  :.||.|||.:.::        
 Frog   274 LTFTVSYLALGMLNFCKF---YLLGFDAFRNGNVMHRGVTEGVTLMLLALQTGLLDL-------- 327

  Fly   394 ARLAQKNYAVMVRDTFLVAVVVTVRLFLATSPPDPFGLIVPPSRKSVFIEVTALPFHTSSEGDSP 458
             ::.|:.:.:.:    ::.:|||..|.......||..|.:..:|.                    
 Frog   328 -QVLQRTFLLSI----ILFIVVTSTLQSMIEIADPIVLALGATRN-------------------- 367

  Fly   459 TTSSEPIKTNMYKDTYKSLNVIP--LGMLLYYIAVSDLIIKLLTMLVKLIITMLPHHLMRLKVRA 521
                        :..:|.|..:.  |.:|::...::..|.:...|...|:|.:....|..|:|..
 Frog   368 ------------RSLWKHLRGVSMCLFLLVFPCFMAYKISQFFHMDFWLLILVSSCMLTSLQVLG 420

  Fly   522 RLYVL------------VEYISQFYRAMTPITQWLLFLYESYSGLEVVSGGLFSAMY-----LGA 569
            .|::.            ||.|.:....:..:::.|.||.    .:.||:.|.:.:::     :|.
 Frog   421 TLFIYALFMVELFHDSQVEKIDEIIYYVNAVSRVLEFLV----AVCVVAYGTWESLFGEWSWMGV 481

  Fly   570 KI------FELVERGKSLKKAIVTFR---KNIDSERPPTKDELDAAGALCPICHDAFNTPTVLEC 625
            .:      |.:..|.:|..|:.:..|   |.|.|....|.::|.|...:||||....:...:..|
 Frog   482 SVIIVHSYFNVWLRAQSGWKSFLLRREAAKKISSLPMATLEQLRAHNDVCPICFQDMSGAVITPC 546

  Fly   626 GHIFCDECVQTWFKREQTCPMCRAKV 651
            .|||..||::.|...:.|||:|..:|
 Frog   547 SHIFHGECLRKWLYVQDTCPICHQQV 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 15/40 (38%)
rnf145lNP_001106467.1 TRC8_N 5..500 CDD:290425 50/277 (18%)
zf-rbx1 <528..569 CDD:289448 14/40 (35%)
zf-RING_2 529..569 CDD:290367 14/39 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.