powered by:
Protein Alignment CG13605 and rnf151
DIOPT Version :9
Sequence 1: | NP_651214.2 |
Gene: | CG13605 / 42858 |
FlyBaseID: | FBgn0039150 |
Length: | 669 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001343919.2 |
Gene: | rnf151 / 100004674 |
ZFINID: | ZDB-GENE-121214-234 |
Length: | 243 |
Species: | Danio rerio |
Alignment Length: | 63 |
Identity: | 22/63 - (34%) |
Similarity: | 31/63 - (49%) |
Gaps: | 5/63 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 592 IDSERPPTKDELDAAGALCPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCPMCRAKVSDD 654
:|....|..|:| :|.||......|..|:|.|:||.||:..|.||:..||.||..:..:
Zfish 7 VDQFVDPPDDDL-----ICVICRAVLRCPVRLKCNHVFCKECILQWMKRQVKCPCCRQSIDQN 64
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13605 | NP_651214.2 |
RING |
610..651 |
CDD:238093 |
18/40 (45%) |
rnf151 | XP_001343919.2 |
RING_Ubox |
20..58 |
CDD:327409 |
16/37 (43%) |
zf-TRAF |
102..157 |
CDD:280357 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4029 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.