DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13605 and rnf151

DIOPT Version :9

Sequence 1:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_001343919.2 Gene:rnf151 / 100004674 ZFINID:ZDB-GENE-121214-234 Length:243 Species:Danio rerio


Alignment Length:63 Identity:22/63 - (34%)
Similarity:31/63 - (49%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 IDSERPPTKDELDAAGALCPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCPMCRAKVSDD 654
            :|....|..|:|     :|.||......|..|:|.|:||.||:..|.||:..||.||..:..:
Zfish     7 VDQFVDPPDDDL-----ICVICRAVLRCPVRLKCNHVFCKECILQWMKRQVKCPCCRQSIDQN 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13605NP_651214.2 RING 610..651 CDD:238093 18/40 (45%)
rnf151XP_001343919.2 RING_Ubox 20..58 CDD:327409 16/37 (43%)
zf-TRAF 102..157 CDD:280357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4029
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.