DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and ZFAND4

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_016872420.1 Gene:ZFAND4 / 93550 HGNCID:23504 Length:741 Species:Homo sapiens


Alignment Length:247 Identity:48/247 - (19%)
Similarity:94/247 - (38%) Gaps:68/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIMEDAMPLSEYRIAEDKIIVLMGKKKVDKSSPEEKVAPTPPLAAGPNVLRTEDVVPS------L 108
            :|:|:::.:::.::.:.|:..:...||..|:   .|:.|.||:|..|:   :....||      :
Human   227 QIIENSITMNKMKLLKAKMKNMNLSKKPKKA---VKIKPHPPVAPRPS---SGSTAPSRHRLLRV 285

  Fly   109 APNDQWVSDLMSMGYGEEEVRSALRASFNHPERAIEYLINGIPQEVVSEQGLAAIPSVQTSDQLQ 173
            .||   :....|..:|                       |..|.| :|..|::::.:        
Human   286 LPN---IGQSCSPAFG-----------------------NAYPPE-ISRNGISSLAT-------- 315

  Fly   174 QLMADLNITRMR-EMIN-----QNPELIHRLMNRLAETDPATFEVFQRNQEELMNMISGGASRTP 232
            ||.|:..|:.:. |.:.     :|..|.|...|  .:..|....:...|.:||.:.:....|..|
Human   316 QLSAERYISSITGEFLKEDNSWENNTLSHFSSN--VKLPPQIPHLELGNDQELADSVLHLGSSLP 378

  Fly   233 NEIEHL---------QITLTAEETAAVGRLEALGFERVMAVQAYLACDKDEQ 275
            .:.:|.         .|.|.:||......|    ..:|.::.::...:.|||
Human   379 RQTKHFLGNLPSSNGNIVLPSEECVTEQSL----LPKVGSLASFAEGNADEQ 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 48/247 (19%)
UBQ 1..76 CDD:294102 3/25 (12%)
UBA1_Rad23_like 110..148 CDD:270466 4/37 (11%)
XPC-binding 172..227 CDD:286376 13/60 (22%)
UBA2_Rad23_like 245..282 CDD:270467 7/31 (23%)
ZFAND4XP_016872420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.