DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and DSK2

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_014003.1 Gene:DSK2 / 855319 SGDID:S000004889 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:59/246 - (23%)
Similarity:95/246 - (38%) Gaps:52/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMGKKKVDKS 80
            |:|.:.|...|:.|........:|..|.:|||||:|::|...:..|.|.:...:.|:      ||
Yeast    15 EVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV------KS 73

  Fly    81 SPEEKVAPTPPLAAGPN------VLRTEDVVPSLAPNDQW----VSDLMSMGY-GEEEVRS---- 130
            .|:.:.|.    |||.|      ........|:::.....    ::||.|..| |...:.|    
Yeast    74 QPKPQTAS----AAGANNATATGAAAGTGATPNMSSGQSAGFNPLADLTSARYAGYLNMPSADMF 134

  Fly   131 -----ALRASFNHPERAIEYLINGIPQEVVSEQGLAAIPS-----VQTSDQLQ----QLMADLNI 181
                 ||....|:.:..:..:.|.|.|..::|  :.:.|.     :|::.|||    |....|..
Yeast   135 GPDGGALNNDSNNQDELLRMMENPIFQSQMNE--MLSNPQMLDFMIQSNPQLQAMGPQARQMLQS 197

  Fly   182 TRMREMINQNPELIHRLMNRLAETDPATFEVFQRNQEELMNMISGGASRTP 232
            ...|:|:. ||::|.:.|......||          ...|....|.||..|
Yeast   198 PMFRQMLT-NPDMIRQSMQFARMMDP----------NAGMGSAGGAASAFP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 59/246 (24%)
UBQ 1..76 CDD:294102 17/59 (29%)
UBA1_Rad23_like 110..148 CDD:270466 9/51 (18%)
XPC-binding 172..227 CDD:286376 13/58 (22%)
UBA2_Rad23_like 245..282 CDD:270467
DSK2NP_014003.1 Ubl_Dsk2p_like 3..74 CDD:340523 18/64 (28%)
STI1 149..185 CDD:128966 7/37 (19%)
UBA_Dsk2p_like 328..369 CDD:270509
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.