DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and RUB1

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_010423.4 Gene:RUB1 / 851717 SGDID:S000002546 Length:77 Species:Saccharomyces cerevisiae


Alignment Length:77 Identity:17/77 - (22%)
Similarity:40/77 - (51%) Gaps:6/77 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
            |.:.::.|..:.|::|:.||..|..:|:.|..  :..:|....:||:.|:.::|.:.:::..:.|
Yeast     1 MIVKVKTLTGKEISVELKESDLVYHIKELLEE--KEGIPPSQQRLIFQGKQIDDKLTVTDAHLVE 63

  Fly    66 DK----IIVLMG 73
            ..    ::.|.|
Yeast    64 GMQLHLVLTLRG 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 17/77 (22%)
UBQ 1..76 CDD:294102 17/77 (22%)
UBA1_Rad23_like 110..148 CDD:270466
XPC-binding 172..227 CDD:286376
UBA2_Rad23_like 245..282 CDD:270467
RUB1NP_010423.4 Ubl_NEDD8 3..76 CDD:340504 16/75 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.