DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and UBI4

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_013061.1 Gene:UBI4 / 850620 SGDID:S000003962 Length:381 Species:Saccharomyces cerevisiae


Alignment Length:285 Identity:55/285 - (19%)
Similarity:117/285 - (41%) Gaps:59/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
            |::.::.|..:|||||:..|..:..:|.|:.:  :..:|.:..:||::|:.:||...||:|.|.:
Yeast     1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQD--KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63

  Fly    66 DKII---------------VLMGKK---KVDKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPND 112
            :..:               .|.||.   :|:.|...:.|         .:.::.::.:|   |:.
Yeast    64 ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV---------KSKIQDKEGIP---PDQ 116

  Fly   113 QWVSDLMSMGYGEEEVRSALRASFNHPERAIEYLI----NGIPQEVVSEQGLAAIPSVQTSDQLQ 173
            |   .|:..|...|:.|:.  :.:|..:.:..:|:    .|:...|.:..|......|::||.:.
Yeast   117 Q---RLIFAGKQLEDGRTL--SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID 176

  Fly   174 QLMADLNITRMREMINQNPELIHRLMNRLAET-----DPATFEVFQRNQEELMNMI---SGGASR 230
            .:.:.:          |:.|.|.....||...     |..|...:...:|..::::   .||...
Yeast   177 NVKSKI----------QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI 231

  Fly   231 TPNEIEHLQITLTAEETAAVGRLEA 255
            ....:....|||..|.:..:..:::
Yeast   232 FVKTLTGKTITLEVESSDTIDNVKS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 55/285 (19%)
UBQ 1..76 CDD:294102 23/92 (25%)
UBA1_Rad23_like 110..148 CDD:270466 8/41 (20%)
XPC-binding 172..227 CDD:286376 8/62 (13%)
UBA2_Rad23_like 245..282 CDD:270467 1/11 (9%)
UBI4NP_013061.1 Ubl_ubiquitin 1..76 CDD:340501 20/76 (26%)
Ubl_ubiquitin 77..152 CDD:340501 15/91 (16%)
Ubl_ubiquitin 153..228 CDD:340501 13/84 (15%)
Ubl_ubiquitin 229..304 CDD:340501 4/28 (14%)
Ubl_ubiquitin 305..380 CDD:340501
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.