DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and RAD23B

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001185439.1 Gene:RAD23B / 844304 AraportID:AT1G79650 Length:395 Species:Arabidopsis thaliana


Alignment Length:409 Identity:100/409 - (24%)
Similarity:170/409 - (41%) Gaps:133/409 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQ-----LIYSGRIMEDAMPLSE 60
            |||:::.|......:.:..|..:.|:|:.:    |.:...:|..     ||::|::::|...|.|
plant     1 MKLTVKTLKGSHFEIRVLPSDTIMAVKKNI----EDSQGKDNYPCGQQLLIHNGKVLKDETSLVE 61

  Fly    61 YRIAEDKIIVLM----------GKKKVDKSSPEEKVAPT--------------PPLAAGPNVLRT 101
            .::.|:..:|:|          |:..|..||..:.|:.|              .|:.|.|...:.
plant    62 NKVTEEGFLVVMLSKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTTQSSPVPASPIPAQE 126

  Fly   102 EDVV--------------------PSLAPND----------------QWVSDLMSMGYG---EEE 127
            :..|                    .|:|..|                |.|..:|.||.|   :|.
plant   127 QPAVYAFVFSFAGLAFCPLYGFPKVSMAQTDTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKET 191

  Fly   128 VRSALRASFNHPERAIEYLINGI--------------------------------------PQEV 154
            |..||||::|:||||::||.:||                                      |||.
plant   192 VTRALRAAYNNPERAVDYLYSGIPQTAEVAVPVPEAQIAGSGAAPVAPASGGPNSSPLDLFPQET 256

  Fly   155 VSEQG---LAAIPSVQTSDQLQQLMADLNITRMREMINQNPELIHRLMNRLAETDPATFEVFQRN 216
            |:..|   |..:..::.:||.|||         |.|::.||:::..::..|.:.:|....:.|.|
plant   257 VAAAGSGDLGTLEFLRNNDQFQQL---------RTMVHSNPQILQPMLQELGKQNPQLLRLIQEN 312

  Fly   217 QEELMNMI------SGGA----SRTPNEIEHLQITLTAEETAAVGRLEALGFERVMAVQAYLACD 271
            |.|.:.::      |.|.    .:...|:.| .|.:|..|..|:.||||:||:|.:.::|:||||
plant   313 QAEFLQLVNEPYEGSDGEGDMFDQPEQEMPH-AINVTPAEQEAIQRLEAMGFDRALVIEAFLACD 376

  Fly   272 KDEQLAAEVLIRQSEEDRD 290
            ::|:|||..|:..|.:..|
plant   377 RNEELAANYLLENSGDFED 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 98/401 (24%)
UBQ 1..76 CDD:294102 19/89 (21%)
UBA1_Rad23_like 110..148 CDD:270466 20/56 (36%)
XPC-binding 172..227 CDD:286376 14/60 (23%)
UBA2_Rad23_like 245..282 CDD:270467 18/36 (50%)
RAD23BNP_001185439.1 rad23 1..392 CDD:273167 99/404 (25%)
RAD23_N 1..78 CDD:176400 18/80 (23%)
UBA1_Rad23_plant 166..215 CDD:270562 20/48 (42%)
XPC-binding 268..323 CDD:286376 15/63 (24%)
UBA2_RAD23_plant 347..389 CDD:270565 20/41 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4837
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53856
OrthoDB 1 1.010 - - D1260050at2759
OrthoFinder 1 1.000 - - FOG0001474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101279
Panther 1 1.100 - - O PTHR10621
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.790

Return to query results.
Submit another query.