DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and UBQ12

DIOPT Version :10

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_564675.1 Gene:UBQ12 / 841949 AraportID:AT1G55060 Length:230 Species:Arabidopsis thaliana


Alignment Length:72 Identity:21/72 - (29%)
Similarity:44/72 - (61%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
            |::.::.|..:|||||:..|..:..||.|:.:  :..:|.:..:||::|:.:||...|::|.|.:
plant    77 MQIFVKTLTGKTITLEVESSDTIDNLKAKIQD--KEGIPPDQQRLIFAGKQLEDGRTLADYNIQK 139

  Fly    66 DKIIVLM 72
            :..:.|:
plant   140 ESTLHLV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 21/72 (29%)
UBQ12NP_564675.1 Ubl1_cv_Nsp3_N-like 1..76 CDD:475130
Ubl_ubiquitin 77..152 CDD:340501 21/72 (29%)
Ubl_ubiquitin 153..228 CDD:340501
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.