DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and AT1G11970

DIOPT Version :10

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_172661.1 Gene:AT1G11970 / 837749 AraportID:AT1G11970 Length:99 Species:Arabidopsis thaliana


Alignment Length:50 Identity:10/50 - (20%)
Similarity:28/50 - (56%) Gaps:2/50 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRI 51
            |:..:.|.::.|.:|::...::..:|:  |...|:.:|:::|...:..|:
plant    44 KVKSQFLSEKKIDIEIDPMDKIEQIKE--GIEEEIGIPSDDLTAEHYNRL 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 10/49 (20%)
AT1G11970NP_172661.1 Ubl1_cv_Nsp3_N-like 44..97 CDD:475130 10/49 (20%)

Return to query results.
Submit another query.