DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and AT5G16090

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_197113.4 Gene:AT5G16090 / 831466 AraportID:AT5G16090 Length:171 Species:Arabidopsis thaliana


Alignment Length:176 Identity:50/176 - (28%)
Similarity:86/176 - (48%) Gaps:30/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PNDQWVSDLMSMGYGEEEVRSALRASFNHPERAIEYLINGIPQEVVSEQGLAAIPSVQTSDQLQQ 174
            |||       |:...::.:.:.:.|| .:| .|.:.||:       ..:.|....:::.:....:
plant    19 PND-------SVAEVKKNIETVMGAS-EYP-AAQQILIH-------KREKLRDETTMEANKVFDK 67

  Fly   175 LMADLNITR--MREMINQNPELIHRLMNRLAETDPA-TFEVFQRNQEELMNMISGGASRTPNEIE 236
            .:..:.||:  :.||..|||.|...:.:..|...|. ..|.|:|:.|          ...|.| :
plant    68 SVIAIIITKGCLEEMEKQNPPLFQMIRHNSAGFVPVLNKESFERDNE----------LAQPEE-D 121

  Fly   237 HLQITLTAEETAAVGRLEALGFERVMAVQAYLACDKDEQLAAEVLI 282
            .||:.:||.:..|:.||||:||||.:.::.:|||:|:|||||..|:
plant   122 LLQLQVTAVDDEAINRLEAMGFERRVVLEVFLACNKNEQLAANFLL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 50/176 (28%)
UBQ 1..76 CDD:294102
UBA1_Rad23_like 110..148 CDD:270466 9/37 (24%)
XPC-binding 172..227 CDD:286376 14/57 (25%)
UBA2_Rad23_like 245..282 CDD:270467 18/36 (50%)
AT5G16090NP_197113.4 UBQ 1..76 CDD:294102 12/72 (17%)
UBQ 1..70 CDD:214563 11/66 (17%)
UBA_like_SF 127..169 CDD:304366 21/41 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1260050at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.