DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and AT7SL-1

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_192206.1 Gene:AT7SL-1 / 828121 AraportID:AT4G02970 Length:270 Species:Arabidopsis thaliana


Alignment Length:273 Identity:53/273 - (19%)
Similarity:103/273 - (37%) Gaps:81/273 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIA-EDKIIVLMG-- 73
            :||::..|:  |..:|:|:..  ...:|.....|...|:.:||.:...:|.|. |.::::.:.  
plant    14 SITIDFGET--VLEIKEKIEK--SQGIPVSKQILYLDGKALEDDLHKIDYMILFESRLLLRISPD 74

  Fly    74 ------------KKKVD----------KSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVS 116
                        .|::|          .||..:|:  |..:|.     |..::..||.       
plant    75 ADPNQSNEQTEQSKQIDDKKQEFCGIQDSSESKKI--TRVMAR-----RVHNIYSSLP------- 125

  Fly   117 DLMSMGYGEEEVRSALRASFNHPERAIEYLINGIPQEVV--SEQGLAAIPSVQTSDQLQQLMADL 179
                 .|..:|:..        |:.:....:.|...:||  :||       ..||...::::.|.
plant   126 -----AYSLDELLG--------PKYSATVAVGGRTNQVVQPTEQ-------ASTSGTAKEVLRDS 170

  Fly   180 NITRMREMINQNPE--LIH--------RLMNRLAETDPATFEVFQRNQEELMNMISGGASRTPNE 234
            : :.:.:.|..||.  .:|        |:::.....|....|:    ::||:.|...|....|:|
plant   171 D-SPVEKKIKTNPMKFTVHVKPYQEDTRMIHVEVNADDNVEEL----RKELVKMQERGELNLPHE 230

  Fly   235 IEHLQITLTAEET 247
            ..|| :.|.:.||
plant   231 AFHL-LGLGSSET 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 53/273 (19%)
UBQ 1..76 CDD:294102 14/78 (18%)
UBA1_Rad23_like 110..148 CDD:270466 3/37 (8%)
XPC-binding 172..227 CDD:286376 11/64 (17%)
UBA2_Rad23_like 245..282 CDD:270467 2/3 (67%)
AT7SL-1NP_192206.1 UBQ 1..69 CDD:214563 14/58 (24%)
ubiquitin 7..74 CDD:278661 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.