DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and EVE1

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_192244.1 Gene:EVE1 / 827964 AraportID:AT4G03350 Length:263 Species:Arabidopsis thaliana


Alignment Length:257 Identity:46/257 - (17%)
Similarity:94/257 - (36%) Gaps:67/257 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMG--- 73
            :||::..|:  |..:|:|:..  ...:|.....|...|:.:||.:...:|.|..:.:::.:.   
plant    14 SITIDFGET--VLQIKEKIEK--SQGIPVSKQILYLDGKALEDDLHKIDYMILFESLLLRISPDA 74

  Fly    74 -----------KKKVDKSSPE--------EKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVSDLM 119
                       .|::|....|        |....|..:|.     |..:|..||.          
plant    75 DPNQSNEQTEQSKQIDDKKQEFCGIQDSSESKKLTRVMAR-----RVHNVYSSLP---------- 124

  Fly   120 SMGYGEEEVRSALRASFNHPERAIEYLINGIPQEVV--SEQGLAAIPSVQTSDQLQQLMADLNIT 182
              .|..:|:..        |:.:....:.|...:||  :||       ..||...::::.|.: :
plant   125 --AYSLDELLG--------PKYSATVTVGGRTNQVVQTTEQ-------ASTSGTAKEVLRDSD-S 171

  Fly   183 RMREMINQNPE--LIH----RLMNRLAETDPATFEVFQRNQEELMNMISGGASRTPNEIEHL 238
            .:.:.|..||.  .:|    :...::.:.:....:..:..::||:.|...|....|:|..||
plant   172 PVEKKIKTNPMKFTVHVKPYQEDTKMIQVEVNADDNVEELRKELVKMQERGELNLPHEAFHL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 46/257 (18%)
UBQ 1..76 CDD:294102 13/77 (17%)
UBA1_Rad23_like 110..148 CDD:270466 3/37 (8%)
XPC-binding 172..227 CDD:286376 8/60 (13%)
UBA2_Rad23_like 245..282 CDD:270467
EVE1NP_192244.1 ubiquitin 5..73 CDD:306702 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.