DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and AT4G03360

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_192245.2 Gene:AT4G03360 / 827958 AraportID:AT4G03360 Length:322 Species:Arabidopsis thaliana


Alignment Length:266 Identity:60/266 - (22%)
Similarity:95/266 - (35%) Gaps:79/266 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LAAGPNVLRTEDVVPSLAPNDQWVSDLMSMGYGEEEVRSA--LRASFNHP----ERAIEYLINGI 150
            |:..|:...|::.||....|.  :.|.|.....|.:..|:  :..||...    :|.|| :..|.
plant    14 LSISPDDNPTQNQVPQSPSNP--IHDTMIKVIIENQSGSSFTIDVSFWDTVLMIKRKIE-MTQGT 75

  Fly   151 PQEVVSEQGLAAIPSV-------------QTSDQLQQLMADLNITRMR-EMINQNPEL----IHR 197
            |   ||:|.|.....|             ..|..|..:..|.|.|:.: ...||:|..    ||.
plant    76 P---VSKQILIFKRKVLQDHLNMFGCQIRHNSRILLSISPDDNPTQNQVPQTNQSPSTPSNPIHE 137

  Fly   198 LMNR-----LAETDPATFEVFQRNQEE---LMNM----ISGGASRTPNEIEHLQITLTAEETAAV 250
            .:|.     ..::...|.|.|.:||::   ||.:    |..|:||....::.| :......|.||
plant   138 FVNNQDSPLSPKSSALTMEKFSKNQQDRPPLMRVVAKRIDNGSSRPSYSLDEL-LAPRDSSTVAV 201

  Fly   251 GRL-------------------------EALGFERVMAVQAY----------LACDKDEQLAAEV 280
            |.:                         ::|..:.::.||.|          .|.|..|:|..| 
plant   202 GSIRNRDQEVKNRVSSPSDSVEEVINITDSLAMKMIVMVQPYGYTRMIQVEVTADDNVEELRKE- 265

  Fly   281 LIRQSE 286
            |::..|
plant   266 LVKMQE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 59/262 (23%)
UBQ 1..76 CDD:294102
UBA1_Rad23_like 110..148 CDD:270466 10/43 (23%)
XPC-binding 172..227 CDD:286376 18/71 (25%)
UBA2_Rad23_like 245..282 CDD:270467 13/71 (18%)
AT4G03360NP_192245.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.